PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g009376m
Common NameCISIN_1g009376mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family GRAS
Protein Properties Length: 537aa    MW: 59996.9 Da    PI: 6.0893
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g009376mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS456.71.5e-1391665361374
               GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilk 92 
                        l+++L++cA+avs+++l la++l+ +l++++s +g+p+qRl ay++e+L arl++s+s+++k+l+++e +   ss+ l+++++++ev+P++k
  orange1.1g009376m 166 LKHVLIACAKAVSENELLLANWLMYELRQMVSVSGEPIQRLGAYMLEGLVARLNSSGSSICKSLRCKEPA---SSDLLSYMHILYEVCPYFK 254
                        689******************************************************************9...9****************** PP

               GRAS  93 fshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlv 182
                        f+++ aN aI ea++ e+rvHiiDf+i+qG QW++L+qa+a+Rp+gpp++RiTg++++ s   +   l  +g+rL+k+Ae+++vpfef++ +
  orange1.1g009376m 255 FGYMSANGAIAEAMKDEDRVHIIDFQIGQGSQWITLIQAFAARPGGPPHIRITGIDDSISAyaRGGGLGIVGKRLSKLAEQFKVPFEFHA-A 345
                        *********************************************************877788999************************.7 PP

               GRAS 183 akrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleak 274
                          +  d++le+Lrv+pgEa+aVn++++lh+++desvs+e++rd++L lvk+lsPkvv++veqe+++n++ F  rfleal+yy+a+f+s++++
  orange1.1g009376m 346 NMSGYDVQLENLRVQPGEAVAVNFAFMLHHVPDESVSTENYRDRLLMLVKRLSPKVVTLVEQESNTNTAAFYPRFLEALNYYTAMFESIDVN 437
                        88999*************************************************************************************** PP

               GRAS 275 lpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrp 366
                        l+r+++eri++E+++l+r++vn++aceg er+erhe l+kWr+r+++aGF+p+pls+ +++++k+ll+++ ++ yr++e++g+l+lgW++r 
  orange1.1g009376m 438 LARDHKERINIEQHCLARDVVNIIACEGPERIERHELLGKWRSRFTMAGFRPYPLSSVVNATIKTLLENYCNR-YRLQERDGALFLGWMNRD 528
                        ***********************************************************************77.****************** PP

               GRAS 367 LvsvSaWr 374
                        Lv+ +aWr
  orange1.1g009376m 529 LVASCAWR 536
                        *******8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098570.639140517IPR005202Transcription factor GRAS
PfamPF035145.1E-137166536IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009640Biological Processphotomorphogenesis
GO:0005737Cellular Componentcytoplasm
GO:0004871Molecular Functionsignal transducer activity
Sequence ? help Back to Top
Protein Sequence    Length: 537 aa     Download sequence    Send to blast
MSGRLYYQPI QEIEPYCLPQ FQTVDHHLQY NDGGKGAHFS LQNSYEQYCT LESSSANGSY  60
TIYNSPSTVT FSPNGSPMSQ QESQSYPPDL HHSPDNAYGS PMSTSCITND ASDLKHKLRE  120
LESVMLGPDS DIIDGIDSTY QNGTNKGSPE MDSGRQIIGA IAKGDLKHVL IACAKAVSEN  180
ELLLANWLMY ELRQMVSVSG EPIQRLGAYM LEGLVARLNS SGSSICKSLR CKEPASSDLL  240
SYMHILYEVC PYFKFGYMSA NGAIAEAMKD EDRVHIIDFQ IGQGSQWITL IQAFAARPGG  300
PPHIRITGID DSISAYARGG GLGIVGKRLS KLAEQFKVPF EFHAANMSGY DVQLENLRVQ  360
PGEAVAVNFA FMLHHVPDES VSTENYRDRL LMLVKRLSPK VVTLVEQESN TNTAAFYPRF  420
LEALNYYTAM FESIDVNLAR DHKERINIEQ HCLARDVVNI IACEGPERIE RHELLGKWRS  480
RFTMAGFRPY PLSSVVNATI KTLLENYCNR YRLQERDGAL FLGWMNRDLV ASCAWR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A5e-611705368375GRAS family transcription factor containing p
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Csi.11410.0fruit
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006447746.10.0hypothetical protein CICLE_v10014845mg
RefseqXP_006469518.10.0PREDICTED: scarecrow-like protein 21
SwissprotQ9LDL70.0PAT1_ARATH; Scarecrow-like transcription factor PAT1
TrEMBLA0A067EX150.0A0A067EX15_CITSI; Uncharacterized protein
STRINGVIT_12s0057g00560.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM62128141
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48150.20.0GRAS family protein